Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary

Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 13,267
  2. Avatar for Team China 12. Team China 1 pt. 13,169
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 12,467
  1. Avatar for Larini 11. Larini Lv 1 43 pts. 13,758
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 39 pts. 13,743
  3. Avatar for akaaka 13. akaaka Lv 1 35 pts. 13,716
  4. Avatar for Galaxie 14. Galaxie Lv 1 32 pts. 13,712
  5. Avatar for fpc 15. fpc Lv 1 29 pts. 13,687
  6. Avatar for JuliaBCollet 16. JuliaBCollet Lv 1 26 pts. 13,686
  7. Avatar for Aubade01 17. Aubade01 Lv 1 24 pts. 13,648
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 21 pts. 13,645
  9. Avatar for BarrySampson 19. BarrySampson Lv 1 19 pts. 13,626
  10. Avatar for georg137 20. georg137 Lv 1 17 pts. 13,603

Comments