Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary

Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 13,267
  2. Avatar for Team China 12. Team China 1 pt. 13,169
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 12,467
  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 15 pts. 13,602
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 14 pts. 13,596
  3. Avatar for zbp 23. zbp Lv 1 12 pts. 13,568
  4. Avatar for alcor29 24. alcor29 Lv 1 11 pts. 13,558
  5. Avatar for orily1337 25. orily1337 Lv 1 10 pts. 13,552
  6. Avatar for Trajan464 26. Trajan464 Lv 1 8 pts. 13,523
  7. Avatar for Hellcat6 27. Hellcat6 Lv 1 7 pts. 13,461
  8. Avatar for pizpot 28. pizpot Lv 1 7 pts. 13,459
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 6 pts. 13,455
  10. Avatar for ProfVince 30. ProfVince Lv 1 5 pts. 13,443

Comments