Placeholder image of a protein
Icon representing a puzzle

2545: Refine Density Reconstruction 16

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 21, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 13,267
  2. Avatar for Team China 12. Team China 1 pt. 13,169
  3. Avatar for Street Smarts 13. Street Smarts 1 pt. 12,467

  1. Avatar for pfirth 41. pfirth Lv 1 1 pt. 13,243
  2. Avatar for NPrincipi 42. NPrincipi Lv 1 1 pt. 13,235
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 1 pt. 13,218
  4. Avatar for manu8170 44. manu8170 Lv 1 1 pt. 13,186
  5. Avatar for zo3xiaJonWeinberg 45. zo3xiaJonWeinberg Lv 1 1 pt. 13,169
  6. Avatar for maithra 46. maithra Lv 1 1 pt. 13,107
  7. Avatar for jamiexq 47. jamiexq Lv 1 1 pt. 13,092
  8. Avatar for nancy_naniewoo 48. nancy_naniewoo Lv 1 1 pt. 13,037
  9. Avatar for carsonfb 49. carsonfb Lv 1 1 pt. 12,990
  10. Avatar for rinze 50. rinze Lv 1 1 pt. 12,981

Comments