Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 0
  1. Avatar for Auntecedent 51. Auntecedent Lv 1 1 pt. 7,938
  2. Avatar for froschi2 52. froschi2 Lv 1 1 pt. 7,806
  3. Avatar for SemperRabbit 53. SemperRabbit Lv 1 1 pt. 7,772
  4. Avatar for gibanez 54. gibanez Lv 1 1 pt. 7,571
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 7,529
  6. Avatar for loulou59 56. loulou59 Lv 1 1 pt. 7,526
  7. Avatar for Swapper242 57. Swapper242 Lv 1 1 pt. 7,481
  8. Avatar for Cain2317 58. Cain2317 Lv 1 1 pt. 7,478
  9. Avatar for Deleted player 59. Deleted player 1 pt. 7,361
  10. Avatar for zo3xiaJonWeinberg 60. zo3xiaJonWeinberg Lv 1 1 pt. 7,326

Comments