Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 0
  1. Avatar for srxnineB 61. srxnineB Lv 1 1 pt. 7,318
  2. Avatar for illex 62. illex Lv 1 1 pt. 7,298
  3. Avatar for bergie72 63. bergie72 Lv 1 1 pt. 7,282
  4. Avatar for futsall 64. futsall Lv 1 1 pt. 7,254
  5. Avatar for andrewgood 65. andrewgood Lv 1 1 pt. 7,247
  6. Avatar for cyschau 66. cyschau Lv 1 1 pt. 7,178
  7. Avatar for nancy_naniewoo 67. nancy_naniewoo Lv 1 1 pt. 7,167
  8. Avatar for TempestRaven 68. TempestRaven Lv 1 1 pt. 7,166
  9. Avatar for furi0us 69. furi0us Lv 1 1 pt. 7,164
  10. Avatar for Sammy3c2b1a0 70. Sammy3c2b1a0 Lv 1 1 pt. 7,110

Comments