Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,901
  2. Avatar for Go Science 2. Go Science 68 pts. 9,879
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 9,771
  4. Avatar for VeFold 4. VeFold 27 pts. 9,651
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,646
  6. Avatar for Contenders 6. Contenders 9 pts. 9,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,550
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,537
  9. Avatar for Australia 9. Australia 1 pt. 9,251
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,807
  1. Avatar for alcor29 21. alcor29 Lv 1 19 pts. 9,489
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 17 pts. 9,455
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 16 pts. 9,384
  4. Avatar for JuliaBCollet 24. JuliaBCollet Lv 1 14 pts. 9,378
  5. Avatar for heather-1 25. heather-1 Lv 1 13 pts. 9,358
  6. Avatar for pfirth 26. pfirth Lv 1 11 pts. 9,355
  7. Avatar for pizpot 27. pizpot Lv 1 10 pts. 9,353
  8. Avatar for akaaka 28. akaaka Lv 1 9 pts. 9,296
  9. Avatar for AlkiP0Ps 29. AlkiP0Ps Lv 1 8 pts. 9,251
  10. Avatar for manu8170 30. manu8170 Lv 1 7 pts. 9,233

Comments