Icon representing a puzzle

2543: Revisiting Puzzle 84: Giant Anemone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,901
  2. Avatar for Go Science 2. Go Science 68 pts. 9,879
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 9,771
  4. Avatar for VeFold 4. VeFold 27 pts. 9,651
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,646
  6. Avatar for Contenders 6. Contenders 9 pts. 9,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,550
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,537
  9. Avatar for Australia 9. Australia 1 pt. 9,251
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,807
  1. Avatar for Th1sN@me!sN0tAPun 31. Th1sN@me!sN0tAPun Lv 1 7 pts. 9,200
  2. Avatar for maithra 32. maithra Lv 1 6 pts. 9,184
  3. Avatar for Crossed Sticks 33. Crossed Sticks Lv 1 5 pts. 9,060
  4. Avatar for nicobul 34. nicobul Lv 1 5 pts. 8,969
  5. Avatar for RichGuilmain 35. RichGuilmain Lv 1 4 pts. 8,943
  6. Avatar for Larini 36. Larini Lv 1 4 pts. 8,826
  7. Avatar for Joanna_H 37. Joanna_H Lv 1 3 pts. 8,807
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 3 pts. 8,807
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 2 pts. 8,806
  10. Avatar for vybi 40. vybi Lv 1 2 pts. 8,796

Comments