Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,581
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,288
  3. Avatar for Team Brasil 13. Team Brasil 1 pt. 8,032
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,917

  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 20 pts. 9,545
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 18 pts. 9,516
  3. Avatar for alcor29 23. alcor29 Lv 1 17 pts. 9,514
  4. Avatar for nicobul 24. nicobul Lv 1 15 pts. 9,379
  5. Avatar for JuliaBCollet 25. JuliaBCollet Lv 1 14 pts. 9,373
  6. Avatar for aru 26. aru Lv 1 12 pts. 9,369
  7. Avatar for Hellcat6 27. Hellcat6 Lv 1 11 pts. 9,343
  8. Avatar for RichGuilmain 28. RichGuilmain Lv 1 10 pts. 9,317
  9. Avatar for heather-1 29. heather-1 Lv 1 9 pts. 9,295
  10. Avatar for Dr.Sillem 30. Dr.Sillem Lv 1 8 pts. 9,266

Comments