Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,046
  2. Avatar for Go Science 2. Go Science 68 pts. 9,913
  3. Avatar for Australia 3. Australia 44 pts. 9,827
  4. Avatar for Contenders 4. Contenders 27 pts. 9,733
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,639
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,569
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,550
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,545
  9. Avatar for VeFold 9. VeFold 1 pt. 9,516
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,217
  1. Avatar for gmn
    1. gmn Lv 1
    100 pts. 10,046
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,040
  3. Avatar for Serca 3. Serca Lv 1 87 pts. 9,913
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 81 pts. 9,881
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 76 pts. 9,842
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 70 pts. 9,832
  7. Avatar for AlkiP0Ps 7. AlkiP0Ps Lv 1 65 pts. 9,827
  8. Avatar for akaaka 8. akaaka Lv 1 60 pts. 9,798
  9. Avatar for meatexplosion 9. meatexplosion Lv 1 56 pts. 9,792
  10. Avatar for grogar7 10. grogar7 Lv 1 52 pts. 9,784

Comments