Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,581
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,288
  3. Avatar for Team Brasil 13. Team Brasil 1 pt. 8,032
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,917

  1. Avatar for Joanna_H 31. Joanna_H Lv 1 7 pts. 9,217
  2. Avatar for blazegeek 32. blazegeek Lv 1 6 pts. 9,205
  3. Avatar for Larini 33. Larini Lv 1 6 pts. 9,173
  4. Avatar for pfirth 34. pfirth Lv 1 5 pts. 9,159
  5. Avatar for abiogenesis 35. abiogenesis Lv 1 5 pts. 9,150
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 4 pts. 9,133
  7. Avatar for carxo 37. carxo Lv 1 4 pts. 9,096
  8. Avatar for manu8170 38. manu8170 Lv 1 3 pts. 9,094
  9. Avatar for ProfVince 39. ProfVince Lv 1 3 pts. 9,036

Comments