Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,046
  2. Avatar for Go Science 2. Go Science 68 pts. 9,913
  3. Avatar for Australia 3. Australia 44 pts. 9,827
  4. Avatar for Contenders 4. Contenders 27 pts. 9,733
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,639
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,569
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,550
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,545
  9. Avatar for VeFold 9. VeFold 1 pt. 9,516
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,217

  1. Avatar for AlphaFold2 51. AlphaFold2 Lv 1 1 pt. 8,657
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 8,596
  3. Avatar for Gerom 53. Gerom Lv 1 1 pt. 8,581
  4. Avatar for Deleted player 54. Deleted player pts. 8,580
  5. Avatar for Auntecedent 55. Auntecedent Lv 1 1 pt. 8,490
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 8,403
  7. Avatar for Tehnologik1 57. Tehnologik1 Lv 1 1 pt. 8,355
  8. Avatar for RWoodcock 58. RWoodcock Lv 1 1 pt. 8,296
  9. Avatar for HelpME 59. HelpME Lv 1 1 pt. 8,288
  10. Avatar for efull 60. efull Lv 1 1 pt. 8,125

Comments