Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 23,911
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 23,688
  3. Avatar for AlkiP0Ps 3. AlkiP0Ps Lv 1 87 pts. 23,337
  4. Avatar for BootsMcGraw 4. BootsMcGraw Lv 1 81 pts. 23,324
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 75 pts. 23,307
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 70 pts. 23,272
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 64 pts. 23,268
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 60 pts. 23,158
  9. Avatar for BarrySampson 9. BarrySampson Lv 1 55 pts. 23,129
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 51 pts. 23,053

Comments