Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 23,688
  3. Avatar for Australia 3. Australia 44 pts. 23,337
  4. Avatar for Contenders 4. Contenders 27 pts. 23,324
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,307
  6. Avatar for VeFold 6. VeFold 9 pts. 23,129
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 22,995
  8. Avatar for Russian team 8. Russian team 3 pts. 22,959
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 22,844
  10. Avatar for Team China 10. Team China 1 pt. 22,242
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 23,911
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 23,688
  3. Avatar for AlkiP0Ps 3. AlkiP0Ps Lv 1 87 pts. 23,337
  4. Avatar for BootsMcGraw 4. BootsMcGraw Lv 1 81 pts. 23,324
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 75 pts. 23,307
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 70 pts. 23,272
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 64 pts. 23,268
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 60 pts. 23,158
  9. Avatar for BarrySampson 9. BarrySampson Lv 1 55 pts. 23,129
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 51 pts. 23,053

Comments