Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for Go Science 100 pts. 23,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 23,688
  3. Avatar for Australia 3. Australia 44 pts. 23,337
  4. Avatar for Contenders 4. Contenders 27 pts. 23,324
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,307
  6. Avatar for VeFold 6. VeFold 9 pts. 23,129
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 22,995
  8. Avatar for Russian team 8. Russian team 3 pts. 22,959
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 22,844
  10. Avatar for Team China 10. Team China 1 pt. 22,242

  1. Avatar for ProfVince 31. ProfVince Lv 1 7 pts. 22,364
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 6 pts. 22,340
  3. Avatar for zbp 33. zbp Lv 1 5 pts. 22,312
  4. Avatar for hookedwarm 34. hookedwarm Lv 1 5 pts. 22,306
  5. Avatar for Th1sN@me!sN0tAPun 35. Th1sN@me!sN0tAPun Lv 1 4 pts. 22,275
  6. Avatar for zo3xiaJonWeinberg 36. zo3xiaJonWeinberg Lv 1 4 pts. 22,242
  7. Avatar for Serca 37. Serca Lv 1 3 pts. 22,238
  8. Avatar for Jenot96 38. Jenot96 Lv 1 3 pts. 22,165
  9. Avatar for TheGUmmer 39. TheGUmmer Lv 1 2 pts. 22,160
  10. Avatar for spvincent 40. spvincent Lv 1 2 pts. 22,135

Comments