Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,421
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,219
  3. Avatar for Team China 13. Team China 1 pt. 8,044
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,725
  1. Avatar for AlkiP0Ps 21. AlkiP0Ps Lv 1 16 pts. 10,558
  2. Avatar for georg137 22. georg137 Lv 1 15 pts. 10,504
  3. Avatar for nicobul 23. nicobul Lv 1 13 pts. 10,461
  4. Avatar for JuliaBCollet 24. JuliaBCollet Lv 1 12 pts. 10,435
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 10 pts. 10,406
  6. Avatar for TheGUmmer 26. TheGUmmer Lv 1 9 pts. 10,370
  7. Avatar for pfirth 27. pfirth Lv 1 8 pts. 10,254
  8. Avatar for maithra 28. maithra Lv 1 7 pts. 10,052
  9. Avatar for jamiexq 29. jamiexq Lv 1 6 pts. 9,944
  10. Avatar for pizpot 30. pizpot Lv 1 6 pts. 9,843

Comments