Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,421
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,219
  3. Avatar for Team China 13. Team China 1 pt. 8,044
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,725

  1. Avatar for manu8170 31. manu8170 Lv 1 5 pts. 9,837
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 4 pts. 9,526
  3. Avatar for Hexafluorouranate 33. Hexafluorouranate Lv 1 4 pts. 9,272
  4. Avatar for Crossed Sticks 34. Crossed Sticks Lv 1 3 pts. 9,151
  5. Avatar for Larini 35. Larini Lv 1 3 pts. 9,112
  6. Avatar for carxo 36. carxo Lv 1 3 pts. 9,088
  7. Avatar for abiogenesis 37. abiogenesis Lv 1 2 pts. 8,962
  8. Avatar for antibot215 38. antibot215 Lv 1 2 pts. 8,906
  9. Avatar for Jenot96 39. Jenot96 Lv 1 2 pts. 8,905
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 2 pts. 8,871

Comments