Icon representing a puzzle

2549: Revisiting Puzzle 86: Nematode

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,421
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,219
  3. Avatar for Team China 13. Team China 1 pt. 8,044
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,725
  1. Avatar for drumpeter18yrs9yrs 41. drumpeter18yrs9yrs Lv 1 1 pt. 8,868
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 1 pt. 8,802
  3. Avatar for Mohoernchen 43. Mohoernchen Lv 1 1 pt. 8,684
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 8,593
  5. Avatar for Trajan464 45. Trajan464 Lv 1 1 pt. 8,522
  6. Avatar for Savas 46. Savas Lv 1 1 pt. 8,421
  7. Avatar for M1M 47. M1M Lv 1 1 pt. 8,419
  8. Avatar for rinze 48. rinze Lv 1 1 pt. 8,335
  9. Avatar for zbp 49. zbp Lv 1 1 pt. 8,331
  10. Avatar for frostschutz 50. frostschutz Lv 1 1 pt. 8,239

Comments