2549: Revisiting Puzzle 86: Nematode
Closed since about 1 year ago
Novice Overall PredictionSummary
- Created
- December 18, 2024
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
- Sequence
- KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP
Top groups
Comments