Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 17,132
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 8,545
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 19,379
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 93 pts. 19,224
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 86 pts. 19,204
  4. Avatar for LociOiling 4. LociOiling Lv 1 79 pts. 19,194
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 73 pts. 19,190
  6. Avatar for Aubade01 6. Aubade01 Lv 1 67 pts. 19,103
  7. Avatar for gmn 7. gmn Lv 1 62 pts. 19,100
  8. Avatar for Museka 8. Museka Lv 1 57 pts. 19,015
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 52 pts. 18,976
  10. Avatar for TheGUmmer 10. TheGUmmer Lv 1 47 pts. 18,968

Comments