Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,379
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 19,234
  3. Avatar for Contenders 3. Contenders 37 pts. 19,224
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 19,190
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 18,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 18,854
  7. Avatar for Australia 7. Australia 2 pts. 18,739
  8. Avatar for VeFold 8. VeFold 1 pt. 18,670
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 18,666
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 17,999
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 19,379
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 93 pts. 19,224
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 86 pts. 19,204
  4. Avatar for LociOiling 4. LociOiling Lv 1 79 pts. 19,194
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 73 pts. 19,190
  6. Avatar for Aubade01 6. Aubade01 Lv 1 67 pts. 19,103
  7. Avatar for gmn 7. gmn Lv 1 62 pts. 19,100
  8. Avatar for Museka 8. Museka Lv 1 57 pts. 19,015
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 52 pts. 18,976
  10. Avatar for TheGUmmer 10. TheGUmmer Lv 1 47 pts. 18,968

Comments