Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups


  1. Avatar for Go Science 100 pts. 19,379
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 19,234
  3. Avatar for Contenders 3. Contenders 37 pts. 19,224
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 19,190
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 18,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 18,854
  7. Avatar for Australia 7. Australia 2 pts. 18,739
  8. Avatar for VeFold 8. VeFold 1 pt. 18,670
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 18,666
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 17,999

  1. Avatar for Merf 61. Merf Lv 1 1 pt. 16,453
  2. Avatar for harvardman 62. harvardman Lv 1 1 pt. 16,367
  3. Avatar for Maximus150 63. Maximus150 Lv 1 1 pt. 15,745
  4. Avatar for Fumiko 64. Fumiko Lv 1 1 pt. 15,455
  5. Avatar for rmoretti 65. rmoretti Lv 1 1 pt. 8,545

Comments