Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,235
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 7,388
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,350
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,470
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 3,852
  1. Avatar for grogar7 11. grogar7 Lv 1 49 pts. 8,952
  2. Avatar for gmn 12. gmn Lv 1 45 pts. 8,914
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 42 pts. 8,902
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 39 pts. 8,854
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 36 pts. 8,825
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 33 pts. 8,802
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 30 pts. 8,801
  8. Avatar for georg137 18. georg137 Lv 1 28 pts. 8,801
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 25 pts. 8,760
  10. Avatar for Dr.Sillem 20. Dr.Sillem Lv 1 23 pts. 8,746

Comments

rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)