Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,136
  2. Avatar for Go Science 2. Go Science 70 pts. 9,107
  3. Avatar for Contenders 3. Contenders 47 pts. 9,095
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 8,967
  5. Avatar for VeFold 5. VeFold 19 pts. 8,884
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 8,825
  7. Avatar for Australia 7. Australia 7 pts. 8,801
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 8,727
  9. Avatar for SETI.Germany 9. SETI.Germany 2 pts. 8,309
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,292

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,134
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 9,107
  3. Avatar for Serca 3. Serca Lv 1 88 pts. 9,098
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 82 pts. 9,095
  5. Avatar for Galaxie 5. Galaxie Lv 1 76 pts. 9,052
  6. Avatar for g_b 6. g_b Lv 1 71 pts. 9,039
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 66 pts. 9,031
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 61 pts. 8,973
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 57 pts. 8,967
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 53 pts. 8,956

Comments


rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)