Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,235
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 7,388
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,350
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,470
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 3,852
  1. Avatar for AlphaFold2 61. AlphaFold2 Lv 1 1 pt. 7,742
  2. Avatar for azerty1 62. azerty1 Lv 1 1 pt. 7,723
  3. Avatar for futsall 63. futsall Lv 1 1 pt. 7,660
  4. Avatar for wojto.htc 64. wojto.htc Lv 1 1 pt. 7,629
  5. Avatar for efull 65. efull Lv 1 1 pt. 7,605
  6. Avatar for Kimdonghyeon 66. Kimdonghyeon Lv 1 1 pt. 7,550
  7. Avatar for harvardman 67. harvardman Lv 1 1 pt. 7,414
  8. Avatar for antibot215 68. antibot215 Lv 1 1 pt. 7,388
  9. Avatar for doctaven 69. doctaven Lv 1 1 pt. 7,350
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 7,326

Comments

rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)