Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,136
  2. Avatar for Go Science 2. Go Science 70 pts. 9,107
  3. Avatar for Contenders 3. Contenders 47 pts. 9,095
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 8,967
  5. Avatar for VeFold 5. VeFold 19 pts. 8,884
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 8,825
  7. Avatar for Australia 7. Australia 7 pts. 8,801
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 8,727
  9. Avatar for SETI.Germany 9. SETI.Germany 2 pts. 8,309
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,292

  1. Avatar for RWoodcock 21. RWoodcock Lv 1 21 pts. 8,733
  2. Avatar for orily1337 22. orily1337 Lv 1 19 pts. 8,727
  3. Avatar for alcor29 23. alcor29 Lv 1 18 pts. 8,719
  4. Avatar for carxo 24. carxo Lv 1 16 pts. 8,711
  5. Avatar for Hellcat6 25. Hellcat6 Lv 1 15 pts. 8,698
  6. Avatar for Larini 26. Larini Lv 1 13 pts. 8,696
  7. Avatar for Museka 27. Museka Lv 1 12 pts. 8,661
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 11 pts. 8,651
  9. Avatar for ppp6 29. ppp6 Lv 1 10 pts. 8,640
  10. Avatar for BarrySampson 30. BarrySampson Lv 1 9 pts. 8,599

Comments


rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)