Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for Larini 31. Larini Lv 1 7 pts. 10,853
  2. Avatar for orily1337 32. orily1337 Lv 1 6 pts. 10,844
  3. Avatar for Crossed Sticks 33. Crossed Sticks Lv 1 6 pts. 10,842
  4. Avatar for ProfVince 34. ProfVince Lv 1 5 pts. 10,797
  5. Avatar for jamiexq 35. jamiexq Lv 1 4 pts. 10,791
  6. Avatar for heather-1 36. heather-1 Lv 1 4 pts. 10,756
  7. Avatar for nicobul 37. nicobul Lv 1 3 pts. 10,752
  8. Avatar for kitsoune 38. kitsoune Lv 1 3 pts. 10,694
  9. Avatar for BarrySampson 39. BarrySampson Lv 1 3 pts. 10,687
  10. Avatar for Tian00 40. Tian00 Lv 1 2 pts. 10,681

Comments