Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for pizpot 41. pizpot Lv 1 2 pts. 10,674
  2. Avatar for aru 42. aru Lv 1 2 pts. 10,659
  3. Avatar for TheGUmmer 43. TheGUmmer Lv 1 2 pts. 10,647
  4. Avatar for zbp 44. zbp Lv 1 1 pt. 10,630
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 1 pt. 10,617
  6. Avatar for Th1sN@me!sN0tAPun 46. Th1sN@me!sN0tAPun Lv 1 1 pt. 10,615
  7. Avatar for Vinara 47. Vinara Lv 1 1 pt. 10,608
  8. Avatar for alyssa_d_V2.0 48. alyssa_d_V2.0 Lv 1 1 pt. 10,555
  9. Avatar for carsonfb 49. carsonfb Lv 1 1 pt. 10,500
  10. Avatar for pfirth 50. pfirth Lv 1 1 pt. 10,477

Comments