Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 10,442
  2. Avatar for Hellcat6 52. Hellcat6 Lv 1 1 pt. 10,442
  3. Avatar for SaraL 53. SaraL Lv 1 1 pt. 10,422
  4. Avatar for Alistair69 54. Alistair69 Lv 1 1 pt. 10,413
  5. Avatar for Trajan464 55. Trajan464 Lv 1 1 pt. 10,412
  6. Avatar for AlphaFold2 56. AlphaFold2 Lv 1 1 pt. 10,253
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 10,041
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,990
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 9,871
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 9,856

Comments