Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,333
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,316
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,314
  4. Avatar for Contenders 4. Contenders 30 pts. 11,269
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 11,189
  6. Avatar for Australia 6. Australia 11 pts. 11,174
  7. Avatar for VeFold 7. VeFold 7 pts. 11,090
  8. Avatar for Kotocycle 8. Kotocycle 4 pts. 11,047
  9. Avatar for Russian team 9. Russian team 2 pts. 10,904
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,844
  1. Avatar for Galaxie 11. Galaxie Lv 1 47 pts. 11,261
  2. Avatar for bravosk8erboy 12. bravosk8erboy Lv 1 44 pts. 11,259
  3. Avatar for g_b 13. g_b Lv 1 40 pts. 11,244
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 37 pts. 11,189
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 34 pts. 11,181
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 31 pts. 11,174
  7. Avatar for blazegeek 17. blazegeek Lv 1 28 pts. 11,145
  8. Avatar for georg137 18. georg137 Lv 1 26 pts. 11,122
  9. Avatar for Museka 19. Museka Lv 1 24 pts. 11,120
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 22 pts. 11,100

Comments