Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,333
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,316
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,314
  4. Avatar for Contenders 4. Contenders 30 pts. 11,269
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 11,189
  6. Avatar for Australia 6. Australia 11 pts. 11,174
  7. Avatar for VeFold 7. VeFold 7 pts. 11,090
  8. Avatar for Kotocycle 8. Kotocycle 4 pts. 11,047
  9. Avatar for Russian team 9. Russian team 2 pts. 10,904
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,844
  1. Avatar for JuliaBCollet 21. JuliaBCollet Lv 1 20 pts. 11,090
  2. Avatar for alcor29 22. alcor29 Lv 1 18 pts. 11,078
  3. Avatar for Ikuso 23. Ikuso Lv 1 16 pts. 11,047
  4. Avatar for maithra 24. maithra Lv 1 15 pts. 11,021
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 13 pts. 11,002
  6. Avatar for rosie4loop 26. rosie4loop Lv 1 12 pts. 10,991
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 11 pts. 10,947
  8. Avatar for Hexafluorouranate 28. Hexafluorouranate Lv 1 10 pts. 10,915
  9. Avatar for Gerom 29. Gerom Lv 1 9 pts. 10,904
  10. Avatar for hookedwarm 30. hookedwarm Lv 1 8 pts. 10,866

Comments