Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Go Science 100 pts. 11,333
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,316
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,314
  4. Avatar for Contenders 4. Contenders 30 pts. 11,269
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 11,189
  6. Avatar for Australia 6. Australia 11 pts. 11,174
  7. Avatar for VeFold 7. VeFold 7 pts. 11,090
  8. Avatar for Kotocycle 8. Kotocycle 4 pts. 11,047
  9. Avatar for Russian team 9. Russian team 2 pts. 10,904
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,844

  1. Avatar for Jenot96 61. Jenot96 Lv 1 1 pt. 9,649
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,524
  3. Avatar for alevbozan 63. alevbozan Lv 1 1 pt. 9,517
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 9,478
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 9,352
  6. Avatar for glaminator 67. glaminator Lv 1 1 pt. 9,317
  7. Avatar for furi0us 68. furi0us Lv 1 1 pt. 9,305
  8. Avatar for harvardman 69. harvardman Lv 1 1 pt. 9,185
  9. Avatar for Sammy3c2b1a0 70. Sammy3c2b1a0 Lv 1 1 pt. 9,160

Comments