Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682

  1. Avatar for Galaxie 11. Galaxie Lv 1 49 pts. 41,887
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 45 pts. 41,807
  3. Avatar for georg137 13. georg137 Lv 1 42 pts. 41,524
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 39 pts. 41,478
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 36 pts. 41,448
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 33 pts. 41,382
  7. Avatar for Museka 17. Museka Lv 1 30 pts. 41,282
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 28 pts. 41,109
  9. Avatar for TheGUmmer 19. TheGUmmer Lv 1 25 pts. 41,108
  10. Avatar for akaaka 20. akaaka Lv 1 23 pts. 40,533

Comments