Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682
  1. Avatar for pfirth 41. pfirth Lv 1 3 pts. 37,778
  2. Avatar for ProfVince 42. ProfVince Lv 1 2 pts. 37,769
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 2 pts. 37,643
  4. Avatar for carsonfb 44. carsonfb Lv 1 2 pts. 37,597
  5. Avatar for Vinara 45. Vinara Lv 1 2 pts. 37,539
  6. Avatar for kitsoune 46. kitsoune Lv 1 1 pt. 37,524
  7. Avatar for JuliaBCollet 47. JuliaBCollet Lv 1 1 pt. 37,242
  8. Avatar for Th1sN@me!sN0tAPun 48. Th1sN@me!sN0tAPun Lv 1 1 pt. 37,136
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 36,537
  10. Avatar for SaraL 50. SaraL Lv 1 1 pt. 36,406

Comments