Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 35,686
  2. Avatar for t0n1 52. t0n1 Lv 1 1 pt. 35,625
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 35,606
  4. Avatar for efull 54. efull Lv 1 1 pt. 35,400
  5. Avatar for rosie4loop 55. rosie4loop Lv 1 1 pt. 35,306
  6. Avatar for RWoodcock 56. RWoodcock Lv 1 1 pt. 35,193
  7. Avatar for Narkael 57. Narkael Lv 1 1 pt. 35,167
  8. Avatar for alevbozan 58. alevbozan Lv 1 1 pt. 35,077
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 35,056
  10. Avatar for LAPUZZAANDREA 60. LAPUZZAANDREA Lv 1 1 pt. 34,953

Comments