Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682
  1. Avatar for Sammy3c2b1a0 61. Sammy3c2b1a0 Lv 1 1 pt. 34,682
  2. Avatar for nancy_naniewoo 62. nancy_naniewoo Lv 1 1 pt. 34,363
  3. Avatar for Penguiroth 63. Penguiroth Lv 1 1 pt. 34,256
  4. Avatar for WuWTq 64. WuWTq Lv 1 1 pt. 34,192
  5. Avatar for furi0us 65. furi0us Lv 1 1 pt. 34,000
  6. Avatar for drumpeter18yrs9yrs 66. drumpeter18yrs9yrs Lv 1 1 pt. 33,747
  7. Avatar for Fabian 67. Fabian Lv 1 1 pt. 33,626
  8. Avatar for Kimdonghyeon 68. Kimdonghyeon Lv 1 1 pt. 28,388
  9. Avatar for Hammerhead 69. Hammerhead Lv 1 1 pt. 24,995
  10. Avatar for witekp 70. witekp Lv 1 1 pt. 0

Comments