2560: Electron Density Reconstruction 104
Closed since about 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- January 09, 2025
- Expires
- Max points
- 100
We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.
- Sequence
- MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP
