2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Summary

• Created: January 09, 2025
• Expires: January 23, 2025 at 18:00 UTC
• Max points: 100

Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

• Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups

• 1. Go Science 100 pts. 42,790
• 2. Anthropic Dreams 60 pts. 42,586
• 3. Contenders 33 pts. 42,565
• 4. L'Alliance Francophone 17 pts. 42,153
• 5. Australia 8 pts. 41,448
• 6. FamilyBarmettler 4 pts. 41,109
• 7. Void Crushers 2 pts. 41,108
• 8. VeFold 1 pt. 40,411
• 9. Gargleblasters 1 pt. 36,406
• 10. METU-BIN 1 pt. 35,077

Top soloists

• 31. manu8170 8 pts. 38,846
• 32. Crossed Sticks 7 pts. 38,832
• 33. Anfinsen_slept_here 6 pts. 38,760
• 34. nellasdim 6 pts. 38,606
• 35. Alistair69 5 pts. 38,500
• 36. hansvandenhof 5 pts. 38,372
• 37. zbp 4 pts. 38,187
• 38. abiogenesis 4 pts. 38,091
• 39. Larini 3 pts. 38,048
• 40. pizpot 3 pts. 37,864