Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,415
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 8,375
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,729
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,849
  2. Avatar for Serca 2. Serca Lv 1 93 pts. 9,808
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 87 pts. 9,794
  4. Avatar for blazegeek 4. blazegeek Lv 1 81 pts. 9,775
  5. Avatar for gmn 5. gmn Lv 1 75 pts. 9,729
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 69 pts. 9,724
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 64 pts. 9,712
  8. Avatar for Museka 8. Museka Lv 1 59 pts. 9,709
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 55 pts. 9,698
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 50 pts. 9,695

Comments