Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since over 1 year ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,849
  2. Avatar for Serca 2. Serca Lv 1 93 pts. 9,808
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 87 pts. 9,794
  4. Avatar for blazegeek 4. blazegeek Lv 1 81 pts. 9,775
  5. Avatar for gmn 5. gmn Lv 1 75 pts. 9,729
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 69 pts. 9,724
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 64 pts. 9,712
  8. Avatar for Museka 8. Museka Lv 1 59 pts. 9,709
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 55 pts. 9,698
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 50 pts. 9,695

Comments