Icon representing a puzzle

2564: Non-Revisiting Puzzle

Closed since about 1 year ago

Summary

Created
January 22, 2025
Expires
Max points
0
Description

This puzzle has been closed for 0 points.
This was supposed to be Revisiting Puzzle 91, but the puzzle-posting-bots had minds of their own and created a mess of a puzzle. We apologize for this (the bots have been severely reprimanded).

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    1 pt. 13,795
  2. Avatar for FamilyBarmettler 2. FamilyBarmettler 1 pt. 13,633
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 1 pt. 13,618
  4. Avatar for Go Science 4. Go Science 1 pt. 13,505
  5. Avatar for Void Crushers 5. Void Crushers 1 pt. 13,311
  6. Avatar for VeFold 6. VeFold 1 pt. 12,857
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 12,663
  8. Avatar for Australia 8. Australia 1 pt. 12,448
  9. Avatar for Contenders 9. Contenders 1 pt. 12,403
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 10,818
  1. Avatar for Mohoernchen 31. Mohoernchen Lv 1 1 pt. 12,049
  2. Avatar for Hexafluorouranate 32. Hexafluorouranate Lv 1 1 pt. 12,015
  3. Avatar for nicobul 33. nicobul Lv 1 1 pt. 11,931
  4. Avatar for pfirth 34. pfirth Lv 1 1 pt. 11,866
  5. Avatar for drumpeter18yrs9yrs 35. drumpeter18yrs9yrs Lv 1 1 pt. 11,633
  6. Avatar for zbp 36. zbp Lv 1 1 pt. 11,594
  7. Avatar for DScott 37. DScott Lv 1 1 pt. 11,462
  8. Avatar for Sammy3c2b1a0 38. Sammy3c2b1a0 Lv 1 1 pt. 10,818
  9. Avatar for nancy_naniewoo 39. nancy_naniewoo Lv 1 1 pt. 10,335
  10. Avatar for JuliaBCollet 40. JuliaBCollet Lv 1 1 pt. 10,030

Comments

bravosk8erboy Lv 1

It looks like historically this puzzle was a single chain and this one is double chain version but the chains are linked. Are segments 65 and 66 meant to be connected? or was this a glitch?

bravosk8erboy Lv 1

The puzzle description says it should only have "four cysteines that oxidize to form two disulfide bonds." Thats two many Bruno.

apetrides Staff Lv 1

hey folks thanks for pointing out this bug! it's been fixed but you will need to delete your existing puzzle files for the change to register on your local machine.

LociOiling Lv 1

Now this puzzle opens with only 70 segments, looks like revisiting puzzle 91, but it says non-revisiting. Previously saved solutions can't be loaded. High scores from the original version persist. Can we get the chimera back, please?