2564: Non-Revisiting Puzzle

Closed since about 1 year ago

Summary

• Created: January 22, 2025
• Expires: January 27, 2025 at 10:00 UTC
• Max points: 0

Description

This puzzle has been closed for 0 points.
This was supposed to be Revisiting Puzzle 91, but the puzzle-posting-bots had minds of their own and created a mess of a puzzle. We apologize for this (the bots have been severely reprimanded).

• Sequence: ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

• 1. L'Alliance Francophone 1 pt. 13,795
• 2. FamilyBarmettler 1 pt. 13,633
• 3. Anthropic Dreams 1 pt. 13,618
• 4. Go Science 1 pt. 13,505
• 5. Void Crushers 1 pt. 13,311
• 6. VeFold 1 pt. 12,857
• 7. Marvin's bunch 1 pt. 12,663
• 8. Australia 1 pt. 12,448
• 9. Contenders 1 pt. 12,403
• 10. Rechenkraft.net 1 pt. 10,818

Top soloists

• 1. christioanchauvin 1 pt. 13,795
• 2. akaaka 1 pt. 13,739
• 3. WBarme1234 1 pt. 13,633
• 4. Museka 1 pt. 13,534
• 5. Serca 1 pt. 13,505
• 6. LociOiling 1 pt. 13,460
• 7. NinjaGreg 1 pt. 13,369
• 8. Bruno Kestemont 1 pt. 13,345
• 9. meatexplosion 1 pt. 13,339
• 10. jamiexq 1 pt. 13,334

Comments

[bravosk8erboy]

It looks like historically this puzzle was a single chain and this one is double chain version but the chains are linked. Are segments 65 and 66 meant to be connected? or was this a glitch?

[Bruno Kestemont]

Moreover, I get 500 bonus points with 3 disulfide bonds (as seen on the view sidechain bonds).

[bravosk8erboy]

This puzzle used to be 70 segments, but this week, it's 156.

As bravosk8erboy notes, segments 65 and 66 are linked, forming a long "straw", with roughly -800,000 ideality.

Some further investigation is needed.

here's the link for the standard version: https://foldit.fandom.com/wiki/Revisiting_puzzle/91:_Virus_Protein

[LociOiling]

This puzzle used to be 70 segments, but this week, it's 156.

As bravosk8erboy notes, segments 65 and 66 are linked, forming a long "straw", with roughly -800,000 ideality.

Some further investigation is needed.

here's the link for the standard version: https://foldit.fandom.com/wiki/Revisiting_puzzle/91:_Virus_Protein

[apetrides]

The puzzle description says it should only have "four cysteines that oxidize to form two disulfide bonds." Thats two many Bruno.

[beta_helix]

Moreover, I get 500 bonus points with 3 disulfide bonds (as seen on the view sidechain bonds).

[LociOiling]

Now this puzzle opens with only 70 segments, looks like revisiting puzzle 91, but it says non-revisiting. Previously saved solutions can't be loaded. High scores from the original version persist. Can we get the chimera back, please?

[LociOiling]

This puzzle used to be 70 segments, but this week, it's 156.

As bravosk8erboy notes, segments 65 and 66 are linked, forming a long "straw", with roughly -800,000 ideality.

Some further investigation is needed.

here's the link for the standard version: https://foldit.fandom.com/wiki/Revisiting_puzzle/91:_Virus_Protein