Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,039
  2. Avatar for Team China 12. Team China 1 pt. 8,649
  3. Avatar for incognito group 13. incognito group 1 pt. 7,756
  1. Avatar for DScott 41. DScott Lv 1 2 pts. 9,078
  2. Avatar for altaris 42. altaris Lv 1 1 pt. 9,039
  3. Avatar for ShadowTactics 43. ShadowTactics Lv 1 1 pt. 8,969
  4. Avatar for Trajan464 44. Trajan464 Lv 1 1 pt. 8,968
  5. Avatar for Th1sN@me!sN0tAPun 45. Th1sN@me!sN0tAPun Lv 1 1 pt. 8,940
  6. Avatar for zbp 46. zbp Lv 1 1 pt. 8,876
  7. Avatar for pizpot 47. pizpot Lv 1 1 pt. 8,853
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 8,792
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 8,786
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 8,784

Comments