Icon representing a puzzle

2565: Revisiting Puzzle 91: Virus Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,039
  2. Avatar for Team China 12. Team China 1 pt. 8,649
  3. Avatar for incognito group 13. incognito group 1 pt. 7,756
  1. Avatar for ksnmk 61. ksnmk Lv 1 1 pt. 8,051
  2. Avatar for efleck01 62. efleck01 Lv 1 1 pt. 7,976
  3. Avatar for just another protein 63. just another protein Lv 1 1 pt. 7,871
  4. Avatar for ingoneato 64. ingoneato Lv 1 1 pt. 7,756
  5. Avatar for Sydefecks 65. Sydefecks Lv 1 1 pt. 7,669
  6. Avatar for agomez2 66. agomez2 Lv 1 1 pt. 5,001
  7. Avatar for heyler 67. heyler Lv 1 1 pt. 4,206
  8. Avatar for kmcintosh 68. kmcintosh Lv 1 1 pt. 3,869

Comments