Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,865
  2. Avatar for BIOTF345 12. BIOTF345 1 pt. 7,955
  3. Avatar for BIOF215 13. BIOF215 1 pt. 7,549
  1. Avatar for heather-1 31. heather-1 Lv 1 14 pts. 9,303
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 13 pts. 9,296
  3. Avatar for pontoon 33. pontoon Lv 1 12 pts. 9,296
  4. Avatar for Ikuso 34. Ikuso Lv 1 11 pts. 9,293
  5. Avatar for pizpot 35. pizpot Lv 1 10 pts. 9,252
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 9 pts. 9,227
  7. Avatar for Apothecary1815 37. Apothecary1815 Lv 1 8 pts. 9,223
  8. Avatar for toshiue 38. toshiue Lv 1 8 pts. 9,220
  9. Avatar for NPrincipi 39. NPrincipi Lv 1 7 pts. 9,039
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 6 pts. 9,025

Comments

beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it