Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,865
  2. Avatar for BIOTF345 12. BIOTF345 1 pt. 7,955
  3. Avatar for BIOF215 13. BIOF215 1 pt. 7,549

  1. Avatar for DScott 61. DScott Lv 1 1 pt. 8,029
  2. Avatar for melonogaster 62. melonogaster Lv 1 1 pt. 7,987
  3. Avatar for Ayush Agarwal 63. Ayush Agarwal Lv 1 1 pt. 7,955
  4. Avatar for Ewink 64. Ewink Lv 1 1 pt. 7,912
  5. Avatar for froschi2 65. froschi2 Lv 1 1 pt. 7,891
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 7,653
  7. Avatar for haleyg 67. haleyg Lv 1 1 pt. 7,639
  8. Avatar for firejuggler 68. firejuggler Lv 1 1 pt. 7,631
  9. Avatar for smitha123 69. smitha123 Lv 1 1 pt. 7,549
  10. Avatar for apetrides 70. apetrides Lv 1 1 pt. 7,504

Comments


beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it