Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,865
  2. Avatar for BIOTF345 12. BIOTF345 1 pt. 7,955
  3. Avatar for BIOF215 13. BIOF215 1 pt. 7,549

  1. Avatar for furi0us 81. furi0us Lv 1 1 pt. 6,750
  2. Avatar for NIL1701 82. NIL1701 Lv 1 1 pt. 6,746
  3. Avatar for maithra 83. maithra Lv 1 1 pt. 6,544
  4. Avatar for MUZAHMAD 84. MUZAHMAD Lv 1 1 pt. 6,436
  5. Avatar for tennisttt123 85. tennisttt123 Lv 1 1 pt. 6,386
  6. Avatar for RockaOrca 86. RockaOrca Lv 1 1 pt. 6,365
  7. Avatar for Unearthtw 87. Unearthtw Lv 1 1 pt. 6,364
  8. Avatar for Pou_You 89. Pou_You Lv 1 1 pt. 4,213
  9. Avatar for short5647 90. short5647 Lv 1 1 pt. 4,147

Comments


beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it