Placeholder image of a protein
Icon representing a puzzle

2572: Electron Density Reconstruction 108

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a quite large, so we would recommend the trim tool on this one. This one also has a big piece of DNA in it!

Sequence
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN MDKLGENLNKALNKLKAAAFVDKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSKKEHIIKIVYEELVKLLGEEAKKLELNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITNPDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLEPFDPKKFISRLLGMGDLESLLEKAEDMVDEKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEERENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKGKSGSGGSGSGKLALALLLLLLALAL GUCUCGUCCCGUGGGGCUCGGCGGUGGGGGAGCAUCUCCUGUAGGGGAGAUGUAACCCCCUUUACCUGCCGAACCCCGCCAGGCCCGGAAGGGAGCAACGGUAGGCAGGACGUCGGCGCUCACGGGGGUGCGGGAC

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 78,585
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 76,574
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 54,155
  4. Avatar for chemiosmotic 14. chemiosmotic 1 pt. 51,673

  1. Avatar for Kimdonghyeon 71. Kimdonghyeon Lv 1 1 pt. 29,048
  2. Avatar for Massin 72. Massin Lv 1 1 pt. 28,717
  3. Avatar for B17flying forterss 73. B17flying forterss Lv 1 1 pt. 25,941
  4. Avatar for xa31 74. xa31 Lv 1 1 pt. 24,950
  5. Avatar for Jacloch 75. Jacloch Lv 1 1 pt. 23,276
  6. Avatar for nede123 76. nede123 Lv 1 1 pt. 23,185
  7. Avatar for Luca 77. Luca Lv 1 1 pt. 23,185
  8. Avatar for SWR_DMaster 78. SWR_DMaster Lv 1 1 pt. 23,185
  9. Avatar for UrLostSock 79. UrLostSock Lv 1 1 pt. 23,185
  10. Avatar for erob08 80. erob08 Lv 1 1 pt. 23,185

Comments


LociOiling Lv 1

Don't be fooled, the non-protein in this puzzle is RNA, not DNA, despite the fact it forms a double helix of sorts. It's all one chain, so no sense and anti-sense to worry about.

One interesting feature of RNA is that you can't cut it. You'll see an "action not permitted on RNA" message if you try cutting it in the GUI.

For RNA, the function structure.GetDistance ( a, b ) returns the distance between atom 1 in segment a and atom 1 in segment b.

LociOiling Lv 1

Just to be clear, for DNA and RNA, structure.GetDistance ( a, a +1 ) gives the distance between the phosphorus atom of one nucleobase (a) and the next nucleobase (a + 1).