Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,591
  2. Avatar for Russian team 12. Russian team 1 pt. 9,358
  3. Avatar for chemiosmotic 13. chemiosmotic 1 pt. 9,056
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,723
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,000
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 54 pts. 10,152
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 51 pts. 10,131
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 47 pts. 10,101
  4. Avatar for Aubade01 14. Aubade01 Lv 1 44 pts. 10,095
  5. Avatar for Galaxie 15. Galaxie Lv 1 41 pts. 10,095
  6. Avatar for akaaka 16. akaaka Lv 1 38 pts. 10,093
  7. Avatar for TheGUmmer 17. TheGUmmer Lv 1 36 pts. 10,079
  8. Avatar for g_b 18. g_b Lv 1 33 pts. 10,076
  9. Avatar for alcor29 19. alcor29 Lv 1 31 pts. 10,043
  10. Avatar for jamiexq 20. jamiexq Lv 1 29 pts. 10,040

Comments