Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,591
  2. Avatar for Russian team 12. Russian team 1 pt. 9,358
  3. Avatar for chemiosmotic 13. chemiosmotic 1 pt. 9,056
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,723
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,000
  1. Avatar for prkfour 71. prkfour Lv 1 1 pt. 8,395
  2. Avatar for lordveznan 72. lordveznan Lv 1 1 pt. 8,355
  3. Avatar for erob08 73. erob08 Lv 1 1 pt. 8,272
  4. Avatar for SuperPedro35 74. SuperPedro35 Lv 1 1 pt. 8,251
  5. Avatar for yavuzhan 75. yavuzhan Lv 1 1 pt. 8,224
  6. Avatar for glaminator 76. glaminator Lv 1 1 pt. 8,221
  7. Avatar for Andros 2000 77. Andros 2000 Lv 1 1 pt. 8,215
  8. Avatar for Kimdonghyeon 78. Kimdonghyeon Lv 1 1 pt. 8,157
  9. Avatar for Arlind1 79. Arlind1 Lv 1 1 pt. 8,146
  10. Avatar for B17flying forterss 80. B17flying forterss Lv 1 1 pt. 8,056

Comments