Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,591
  2. Avatar for Russian team 12. Russian team 1 pt. 9,358
  3. Avatar for chemiosmotic 13. chemiosmotic 1 pt. 9,056
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,723
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,000
  1. Avatar for Swapper242 81. Swapper242 Lv 1 1 pt. 8,034
  2. Avatar for Sammy3c2b1a0 82. Sammy3c2b1a0 Lv 1 1 pt. 8,000
  3. Avatar for dpg00035 83. dpg00035 Lv 1 1 pt. 7,832
  4. Avatar for duyanh0511 84. duyanh0511 Lv 1 1 pt. 7,583
  5. Avatar for w.mikus 85. w.mikus Lv 1 1 pt. 4,839
  6. Avatar for AlphaFold2 86. AlphaFold2 Lv 1 1 pt. 3,821

Comments